DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and hpcal1

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_957458.1 Gene:hpcal1 / 394139 ZFINID:ZDB-GENE-040426-1242 Length:193 Species:Danio rerio


Alignment Length:186 Identity:85/186 - (45%)
Similarity:124/186 - (66%) Gaps:5/186 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSSKDRLTKEDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEE 65
            ||..:||  |..|.:..|:.:|.:.:..::|||:||.:|||:|.||..:|..:|..|||.|:|.:
Zfish     1 MGKQNSK--LRPEVLNDLRENTEFTDHELQEWYRGFLKDCPSGHLTVEEFKKIYANFFPYGDASK 63

  Fly    66 FCDHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAI 130
            |.:|||||||.:.:..|||:||::|:.|||.|..|:||:|||.|||:||||.|...||.:|||||
Zfish    64 FAEHVFRTFDTNSDATIDFREFIIALSVTSRGGLEQKLRWAFSMYDLDGNGYISRAEMLEIVQAI 128

  Fly   131 YDMLGACSSNRPADSA--EERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKML 184
            |.|:.:. ...|.|.:  |:|...||.:||.:|||:|:.:||:||...|..:.::|
Zfish   129 YKMVSSV-MKMPEDESTPEKRTDKIFRQMDTDNDGRLSLEEFIKGAKSDPSIVRLL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 77/161 (48%)
hpcal1NP_957458.1 FRQ1 13..179 CDD:227455 78/166 (47%)
EFh <36..89 CDD:298682 26/52 (50%)
EFh 65..126 CDD:238008 34/60 (57%)
EFh 100..174 CDD:238008 38/74 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576102
Domainoid 1 1.000 57 1.000 Domainoid score I10809
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.