DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and kcnip3b

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_957076.1 Gene:kcnip3b / 393755 ZFINID:ZDB-GENE-040426-1752 Length:259 Species:Danio rerio


Alignment Length:171 Identity:66/171 - (38%)
Similarity:106/171 - (61%) Gaps:5/171 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEEFCDHVFRTFDMD 77
            |.:|.|:..|::....::..|:|||.:||:|.:....|..:|..|||.|:|..:...:|..||||
Zfish    80 EGLEQLQAQTQFTRKELQSLYRGFKNECPSGLVDEETFKSIYSQFFPQGDATTYAHFLFNAFDMD 144

  Fly    78 KNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRP 142
            :||.|.|::|::.:.|...|:..|||:|||.:||::.:|.|..:||..|:::||||:|..:|  |
Zfish   145 RNGSIRFEDFVIGLSVLLRGSVTEKLRWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRYTS--P 207

  Fly   143 A---DSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEEL 180
            .   |:|.|..:..|.|||.|.||.:|.:||::.|.:||.:
Zfish   208 CVKDDAAFEHVEKFFQKMDRNRDGVVTLEEFIETCQKDENI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 62/162 (38%)
kcnip3bNP_957076.1 FRQ1 82..248 CDD:227455 65/167 (39%)
EF-hand_8 108..155 CDD:290545 18/46 (39%)
EFh 133..195 CDD:238008 25/61 (41%)
EFh 169..240 CDD:238008 32/72 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576114
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.