DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and guca1e

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_956950.1 Gene:guca1e / 393629 ZFINID:ZDB-GENE-040426-1577 Length:198 Species:Danio rerio


Alignment Length:188 Identity:67/188 - (35%)
Similarity:110/188 - (58%) Gaps:24/188 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSSKDRLTKEDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEE 65
            ||..||   ::..::...|.|         :||:.|..:||:|:||..:|    |.||...|..|
Zfish     1 MGDSSS---MSATELSACKCH---------QWYRKFMTECPSGQLTFYEF----KKFFGLKNLSE 49

  Fly    66 ----FCDHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKI 126
                :.:.:|:|||:|.:|.|||.|::.|:.:...|..::||:|.|:::|:||:|.||..|:..|
Zfish    50 KSNAYVNTMFKTFDIDDDGCIDFMEYVAALSLVLKGGVQQKLRWYFKLFDMDGSGCIDKDELLLI 114

  Fly   127 VQAIYDMLGACSSNRPADSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKML 184
            .:|:..:.||    .|..|||:.|..:|.|:|.|.||:|:.:||::|...||::|:||
Zfish   115 FKAVQAINGA----EPEISAEDLADMVFNKIDVNGDGELSLEEFMEGISADEKISEML 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 58/163 (36%)
guca1eNP_956950.1 FRQ1 4..164 CDD:227455 62/179 (35%)
EF-hand_8 29..79 CDD:290545 20/53 (38%)
EFh 58..112 CDD:238008 23/53 (43%)
EFh 90..159 CDD:238008 30/72 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576088
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.