DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and guca1c

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_919374.1 Gene:guca1c / 373099 ZFINID:ZDB-GENE-030829-1 Length:188 Species:Danio rerio


Alignment Length:180 Identity:63/180 - (35%)
Similarity:98/180 - (54%) Gaps:19/180 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSKDRLTKEDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEEFCDH 69
            |:.|.:..|||.:              ||..|.::.|:|.:|..:..:|.:|...:..|..:.|.
Zfish     6 SNLDEVLAEDMHY--------------WYNKFMRESPSGLITLFELKNMLEMQGMTEEASSYVDQ 56

  Fly    70 VFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDML 134
            ||.|||||.:|||||.|::.|:.:...|...:||||.|:::|.||||.||..||..|.:||.|: 
Zfish    57 VFFTFDMDGDGYIDFVEYIAAVSLLLKGEINQKLKWYFKLFDQDGNGKIDRDEMETIFKAIQDI- 120

  Fly   135 GACSSNRPADSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKML 184
             ..|...|.|   :....|:.::|.||:|:||.:||:.|..:..::.:||
Zfish   121 -TRSYEIPPD---DIVSLIYERIDVNNEGELTLEEFITGAKEHPDIMEML 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 56/159 (35%)
guca1cNP_919374.1 FRQ1 6..162 CDD:227455 61/174 (35%)
EFh 53..110 CDD:238008 28/56 (50%)
EFh 89..157 CDD:238008 31/72 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576123
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.