DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and CG2256

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster


Alignment Length:204 Identity:42/204 - (20%)
Similarity:80/204 - (39%) Gaps:46/204 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSSKDRLTKEDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAK------------------- 49
            |..|.|.||::::           .:...|:....:|.....|.|.                   
  Fly   116 LRKKTRFTKDELD-----------ALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDR 169

  Fly    50 --FVDMYKMFFPSGNAEEFCDHVFRTFDMDKNGY-IDFKEFLLAIDVTSSGTPEEKLKWAFRMYD 111
              |.::....|.....|...:.:|.::|....|. :..:.:|:.:.....|||.|:..:.||:||
  Fly   170 IVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYD 234

  Fly   112 VDGNGVIDIQEMTKIVQAIYDMLGACSSNRPAD-SAEERAKN----IFAKMDENNDGQLTQDEFL 171
            ::.:|.|...||       :.:|..|...:|.| ..:|..|:    :..|.|.:.||:::.::|:
  Fly   235 LNTDGFITKDEM-------FTLLRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFM 292

  Fly   172 KGCLQDEEL 180
             |.:..|.|
  Fly   293 -GTVTAEPL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 35/186 (19%)
CG2256NP_572437.2 EFh 228..292 CDD:238008 18/70 (26%)
EF-hand_7 229..292 CDD:290234 18/69 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442278
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
54.840

Return to query results.
Submit another query.