DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and Guca1b

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001101668.1 Gene:Guca1b / 316218 RGDID:1308191 Length:201 Species:Rattus norvegicus


Alignment Length:169 Identity:68/169 - (40%)
Similarity:101/169 - (59%) Gaps:13/169 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFP-SGNAE--EFCDHVFRTFDMDKNGYIDFKE 86
            |.|.::||||.|..:||:|.|    |:..:|.||. :||.|  ::.:.:||.||.:.:..|||.|
  Rat    17 DVAELQEWYKKFVVECPSGTL----FMHEFKRFFKVTGNEEATQYVEGMFRAFDKNGDNTIDFLE 77

  Fly    87 FLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRPAD------S 145
            ::.|:::...||.|.||||.|::||.|.||.||..|:..||:|||.:..||.:....:      :
  Rat    78 YVAALNLVLRGTLEHKLKWTFKIYDKDRNGCIDRLELLDIVEAIYKLKKACRAELDLEQQGQLLT 142

  Fly   146 AEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKML 184
            .||....||..:|||.||||:..||::|..:|:.:.|||
  Rat   143 PEEVVDRIFLLVDENGDGQLSLTEFIEGARRDKWVMKML 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 64/161 (40%)
Guca1bNP_001101668.1 FRQ1 15..175 CDD:227455 64/161 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336991
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.