DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and KCNIP3

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_038462.1 Gene:KCNIP3 / 30818 HGNCID:15523 Length:256 Species:Homo sapiens


Alignment Length:171 Identity:64/171 - (37%)
Similarity:101/171 - (59%) Gaps:5/171 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEEFCDHVFRTFDMD 77
            |.::.|:..|::.:..::..|:|||.:||.|.:....|..:|..|||.|:|..:...:|..||.|
Human    77 EGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQFFPQGDATTYAHFLFNAFDAD 141

  Fly    78 KNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRP 142
            .||.|.|::|::.:.:...||..|||||||.:||::.:|.|..:||..|:::||||:|  ....|
Human   142 GNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGYITKEEMLAIMKSIYDMMG--RHTYP 204

  Fly   143 ---ADSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEEL 180
               .|:..|..:..|.|||.|.||.:|.:|||:.|.:||.:
Human   205 ILREDAPAEHVERFFEKMDRNQDGVVTIEEFLEACQKDENI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 61/162 (38%)
KCNIP3NP_038462.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
FRQ1 81..245 CDD:227455 63/165 (38%)
EFh 130..192 CDD:238008 25/61 (41%)
EFh 166..238 CDD:238008 32/73 (44%)
Interaction with KCND2. /evidence=ECO:0000250 243..256 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143249
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.