DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and Efcab1

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001100400.1 Gene:Efcab1 / 301957 RGDID:1594548 Length:212 Species:Rattus norvegicus


Alignment Length:119 Identity:33/119 - (27%)
Similarity:64/119 - (53%) Gaps:2/119 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYD 132
            |.|||.||.|.:|.|...|::..:.:...||.:||:|:.|.::|::|:|.|..:||..:::  ..
  Rat    71 DRVFRGFDRDNDGCISVSEWVHGLSLFLRGTLDEKMKYCFEVFDLNGDGFISKEEMFHMLK--NS 133

  Fly   133 MLGACSSNRPADSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKMLAP 186
            :|...|...|.:..::..:....|||.::||:|:..::.....::..|.:...|
  Rat   134 LLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFVDYETAVREETLLLEAFGP 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 31/109 (28%)
Efcab1NP_001100400.1 EF-hand_7 70..130 CDD:290234 22/58 (38%)
EFh 72..131 CDD:238008 21/58 (36%)
EFh 105..168 CDD:238008 18/64 (28%)
EF-hand_7 106..175 CDD:290234 17/70 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336989
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.