DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and Guca1a

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001100357.1 Gene:Guca1a / 301233 RGDID:1308712 Length:202 Species:Rattus norvegicus


Alignment Length:150 Identity:61/150 - (40%)
Similarity:97/150 - (64%) Gaps:3/150 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEEFCDHVFRTFDMDKNGYIDFKEFLLAIDVTS 95
            :|||.|..:||:|:||..:|...:.:...|.:|.::.:.:|.|||.:|:|||||.|::.|:.:..
  Rat    20 QWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVL 84

  Fly    96 SGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRPADSAEERAKNIFAKMDEN 160
            .|..|:||:|.|::|||||||.||..|:..|::||..:.....|:.   ||||....:|||:|.|
  Rat    85 KGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIRAIRTINPWSDSSM---SAEEFTDTVFAKIDIN 146

  Fly   161 NDGQLTQDEFLKGCLQDEEL 180
            .||:|:.:||::|..:|:.|
  Rat   147 GDGELSLEEFMEGVQKDQML 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 59/146 (40%)
Guca1aNP_001100357.1 FRQ1 12..163 CDD:227455 59/145 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336969
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.