DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and GUCA1B

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_002089.4 Gene:GUCA1B / 2979 HGNCID:4679 Length:200 Species:Homo sapiens


Alignment Length:168 Identity:67/168 - (39%)
Similarity:99/168 - (58%) Gaps:12/168 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEE---FCDHVFRTFDMDKNGYIDFKE 86
            |.|.::||||.|..:||:|.|    |:..:|.||...:.||   :.:.:||.||.:.:..|||.|
Human    17 DVAELQEWYKKFVMECPSGTL----FMHEFKRFFKVTDDEEASQYVEGMFRAFDKNGDNTIDFLE 77

  Fly    87 FLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRPAD-----SA 146
            ::.|:::...||.|.||||.|::||.||||.||..|:..||:.||.:..||......:     :.
Human    78 YVAALNLVLRGTLEHKLKWTFKIYDKDGNGCIDRLELLNIVEGIYQLKKACRRELQTEQGQLLTP 142

  Fly   147 EERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKML 184
            ||....||..:|||.||||:.:||::|..:|:.:.|||
Human   143 EEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKML 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 63/160 (39%)
GUCA1BNP_002089.4 FRQ1 20..174 CDD:227455 61/157 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143252
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1322
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.