DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and ncs1

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_592879.1 Gene:ncs1 / 2542523 PomBaseID:SPAC18B11.04 Length:190 Species:Schizosaccharomyces pombe


Alignment Length:186 Identity:84/186 - (45%)
Similarity:122/186 - (65%) Gaps:3/186 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSSKDRLTKEDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEE 65
            ||  .|:.:|:::.::.|...||:|:..:::|||||.:|||:|.|..::|..:||.|||.|:...
pombe     1 MG--KSQSKLSQDQLQDLVRSTRFDKKELQQWYKGFFKDCPSGHLNKSEFQKIYKQFFPFGDPSA 63

  Fly    66 FCDHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAI 130
            |.::||..||.|||||||||||:.|:.|||.|...:||.|||::||:|.||:|...||.:||.||
pombe    64 FAEYVFNVFDADKNGYIDFKEFICALSVTSRGELNDKLIWAFQLYDLDNNGLISYDEMLRIVDAI 128

  Fly   131 YDMLGA-CSSNRPADSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKMLA 185
            |.|:|: .......|:.|:|...||..||:|.|||||.:||.:|..:|..:...|:
pombe   129 YKMVGSMVKLPEDEDTPEKRVNKIFNMMDKNKDGQLTLEEFCEGSKRDPTIVSALS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 78/160 (49%)
ncs1NP_592879.1 FRQ1 9..179 CDD:227455 79/169 (47%)
EFh <36..86 CDD:298682 27/49 (55%)
EFh 65..125 CDD:238008 33/59 (56%)
EFh 100..172 CDD:238008 35/71 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.