DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and Usp32

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_011247292.1 Gene:Usp32 / 237898 MGIID:2144475 Length:1618 Species:Mus musculus


Alignment Length:122 Identity:34/122 - (27%)
Similarity:58/122 - (47%) Gaps:13/122 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 VFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDML 134
            :|..||.:::.:|||||....:.....|...|:.|:.|:::|||.:||:...|:..:|.|   :|
Mouse   236 LFNAFDENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDVDRDGVLSRVELKDMVVA---LL 297

  Fly   135 GACSSNRPADSAE------ERAKNIFAKMDENNDGQLTQDEF----LKGCLQDEELS 181
            .....||..|..|      :..:.|....|....|.||.:::    :|..|.:|.|:
Mouse   298 EVWKDNRTDDIPELHMDLSDIVERILNAHDTTKVGHLTLEDYQIWSVKNVLANEFLN 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 32/117 (27%)
Usp32XP_011247292.1 FRQ1 189..339 CDD:227455 30/105 (29%)
UBP12 518..1330 CDD:227847
UCH <1248..1578 CDD:366104
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.