DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and ncs-1

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_508186.1 Gene:ncs-1 / 180448 WormBaseID:WBGene00003563 Length:191 Species:Caenorhabditis elegans


Alignment Length:187 Identity:83/187 - (44%)
Similarity:114/187 - (60%) Gaps:5/187 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSSKDRLTKEDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEE 65
            ||..:||  |....:..|...|.:.|..||:|||||.:|||||.||.|.|..:||.|||.|:..:
 Worm     1 MGKGNSK--LKSSQIRDLAEQTYFTEKEIKQWYKGFVRDCPNGMLTEAGFQKIYKQFFPQGDPSD 63

  Fly    66 FCDHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAI 130
            |...||:.||.:|:|.|:|.||:.|:.:||.|..:|||.|||::||:|.:|.|...||..||.:|
 Worm    64 FASFVFKVFDENKDGAIEFHEFIRALSITSRGNLDEKLHWAFKLYDLDQDGFITRNEMLSIVDSI 128

  Fly   131 YDMLGACSSNRPAD--SAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKMLA 185
            |.|:|: |...|.:  :.|:|...||..||:|||.|||.:||.:|...|..:...|:
 Worm   129 YKMVGS-SVQLPEEENTPEKRVDRIFRMMDKNNDAQLTLEEFKEGAKADPSIVHALS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 76/161 (47%)
ncs-1NP_508186.1 FRQ1 11..179 CDD:227455 77/168 (46%)
EFh 67..125 CDD:238008 27/57 (47%)
EFh 100..174 CDD:238008 35/74 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.