DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and ncs-6

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_494569.1 Gene:ncs-6 / 173700 WormBaseID:WBGene00021116 Length:338 Species:Caenorhabditis elegans


Alignment Length:186 Identity:40/186 - (21%)
Similarity:78/186 - (41%) Gaps:42/186 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEEFCDHVFRTFDMDK-NGYIDFK 85
            |.::...|...|:.|||.|.|||:|.:::..:::..||..|...|.|.::......| :..|.|:
 Worm    97 TGFNRKWIMFMYRNFKQKCSNGRMTDSQWRILFRSIFPQANDSAFIDRLYAAIVKKKQHPQITFE 161

  Fly    86 EFLLAI-DVTSSGTPEE----------KLKWAFRMYDVDGNGVIDIQEMTKIVQAIY-------- 131
            :.:|.: :::..|...|          :.::||::.|.:|.|.:|.....|..:.::        
 Worm   162 DLILCLWELSEDGKTSEMGNYHINSSARAQFAFQLMDEEGKGRVDEPGFYKYTRCVFALTAVNKP 226

  Fly   132 ---DMLGACSSNRPADS------------------AEERAKNIFAKMDENNDGQLT 166
               .::.|.:...||.|                  |...:|. |.::|.:.||.:|
 Worm   227 CTDQIIDASTIGLPASSIYRSTSVDDVLKPMSPLIARFSSKR-FKELDTDRDGFIT 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 40/186 (22%)
ncs-6NP_494569.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.