DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and Rcvrn

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_543177.2 Gene:Rcvrn / 140936 RGDID:620258 Length:202 Species:Rattus norvegicus


Alignment Length:183 Identity:71/183 - (38%)
Similarity:123/183 - (67%) Gaps:3/183 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSKDRLTKEDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEEFCDH 69
            |....|:||.:|.|:.:|::.|..:..||:.|.::||:||:|..:|..:|..|||..:.:.:..|
  Rat     4 SKSGALSKEILEELQLNTKFTEEELSAWYQSFLKECPSGRITRQEFESIYSKFFPDSDPKAYAQH 68

  Fly    70 VFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDML 134
            |||:||.:.:|.:||||:::|:.:|::|.|.:||:|||.:|||||||.|...|:.:||.||:.|:
  Rat    69 VFRSFDANSDGTLDFKEYVIALHMTTAGKPTQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMI 133

  Fly   135 GACS-SNRPAD--SAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKML 184
            .... .|.|.|  :.|:||:.|:|...:.:|.:||::||::|.|.::|:.:::
  Rat   134 KPEDVKNLPDDENTPEKRAEKIWAFFGKKDDDKLTEEEFIEGTLANKEILRLI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 65/162 (40%)
RcvrnNP_543177.2 FRQ1 14..182 CDD:227455 66/167 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336990
Domainoid 1 1.000 59 1.000 Domainoid score I10424
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.810

Return to query results.
Submit another query.