DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and guca1b

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_571946.1 Gene:guca1b / 140431 ZFINID:ZDB-GENE-011128-6 Length:197 Species:Danio rerio


Alignment Length:191 Identity:70/191 - (36%)
Similarity:107/191 - (56%) Gaps:21/191 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSSKDRLTKEDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFF---PSGN 62
            ||...|.|...||          .|.|.::||||.|..:||:|.|    |:..:|.||   .:..
Zfish     1 MGQRLSDDSDEKE----------IDVAELQEWYKKFVIECPSGTL----FMHDFKSFFGVTENPE 51

  Fly    63 AEEFCDHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIV 127
            |.::.:::||.||.:.:..|||.|::.|:::...|..|.||||.|:|||.||:|.||..|:.:||
Zfish    52 AADYIENMFRAFDKNGDNTIDFLEYVAALNLVLRGKLEHKLKWTFKMYDKDGSGCIDKTELKEIV 116

  Fly   128 QAIYDMLGACSSNRPAD----SAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKML 184
            ::||.:..||.....|:    :.::....||..:|||.||:|:.|||:.|..:|:.:.|||
Zfish   117 ESIYRLKKACHGELDAECNLLTPDQVVDRIFELVDENGDGELSLDEFIDGARRDKWVMKML 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 60/166 (36%)
guca1bNP_571946.1 FRQ1 1..171 CDD:227455 66/183 (36%)
EFh <29..77 CDD:298682 17/51 (33%)
EFh 55..116 CDD:238008 25/60 (42%)
EFh 91..168 CDD:238008 33/76 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576118
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.