DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and guca1a

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_571945.1 Gene:guca1a / 140430 ZFINID:ZDB-GENE-011128-5 Length:189 Species:Danio rerio


Alignment Length:180 Identity:71/180 - (39%)
Similarity:105/180 - (58%) Gaps:24/180 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TKEDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFF------PSGNAEEFCDH 69
            |.:|::.::.|.         |||.|..:||:|:||..:|    |.||      |..||  :.:.
Zfish     8 TVDDLQAVEMHL---------WYKKFMTECPSGQLTLHEF----KQFFGLRGLDPKANA--YIEQ 57

  Fly    70 VFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDML 134
            :||||||:|:|||||.|::.|:.:...|..|.||:|.|::|||||||.||..|:..|::||..:.
Zfish    58 MFRTFDMNKDGYIDFMEYVAALSLVMRGKMEHKLRWYFKLYDVDGNGCIDRYELLNIIKAIRAIN 122

  Fly   135 GACSSNRPADSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKML 184
            |   |.....||||....:|.::|.|.||:|:.|||:.|...|||..:::
Zfish   123 G---SETQESSAEEFTNRVFERIDINGDGELSLDEFVAGARSDEEFMEVM 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 66/165 (40%)
guca1aNP_571945.1 EFh <27..76 CDD:298682 25/54 (46%)
EFh 54..116 CDD:238008 31/61 (51%)
EF-hand_7 55..115 CDD:290234 30/59 (51%)
EFh 90..160 CDD:238008 33/72 (46%)
EF-hand_7 91..157 CDD:290234 31/68 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576113
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.