DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and kcnip4

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_002936758.1 Gene:kcnip4 / 100491280 XenbaseID:XB-GENE-5753458 Length:233 Species:Xenopus tropicalis


Alignment Length:171 Identity:63/171 - (36%)
Similarity:105/171 - (61%) Gaps:5/171 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEEFCDHVFRTFDMD 77
            |.:|.|:..|::.:..::..|:|||.:||:|.:....|.|:|..|||.|:|..:...:|..||.|
 Frog    54 EALELLEAQTKFTKKELQILYRGFKNECPSGIVNEETFKDIYAQFFPQGDASTYAHFLFNAFDTD 118

  Fly    78 KNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRP 142
            .||.:.|::|::.:.....||.:|||.|||.:||::.:|.|..:||..|:::||||:|.|:  .|
 Frog   119 HNGSVSFEDFVIGLSTLLRGTIQEKLNWAFNLYDINKDGYITKEEMFDIMKSIYDMMGKCT--YP 181

  Fly   143 ---ADSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEEL 180
               .::..:..:|.|.|||.|.||.:|.:||::.|.:||.:
 Frog   182 LVREETPRQHVENFFQKMDINKDGVVTIEEFIESCQKDENI 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 59/162 (36%)
kcnip4XP_002936758.1 FRQ1 63..222 CDD:227455 60/160 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.