DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and guca1bl

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_004913416.1 Gene:guca1bl / 100379842 XenbaseID:XB-GENE-5838913 Length:233 Species:Xenopus tropicalis


Alignment Length:202 Identity:69/202 - (34%)
Similarity:118/202 - (58%) Gaps:22/202 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSSKDRLTK---------EDMEFLKTHTRY----DEATIKEWYKGFKQDCPNGRLTPAKFVD 52
            :||.|:..::::         ::....:|...|    |.|.:::.||.|..:||:|.|    |:.
 Frog    16 LGCSSAIHQVSRNKSTLHRGTQEQAMGQTQAAYKDEIDVADLQDMYKKFVTECPSGAL----FLH 76

  Fly    53 MYKMFF-PSGNAE--EFCDHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDG 114
            .:|.|| .|.|.|  :|.:.:|::||.:::..|||.|::.|:::|..|..|.||:|:|::||.||
 Frog    77 EFKQFFGVSANNEVSQFMESLFKSFDRNRDNTIDFLEYVAALNLTLRGKLEHKLRWSFKIYDKDG 141

  Fly   115 NGVIDIQEMTKIVQAIYDMLGACSSNRPAD--SAEERAKNIFAKMDENNDGQLTQDEFLKGCLQD 177
            ||.:|.:|:.:|:|:||.:......::.|.  |.||..:.||..:|||.||||:..||::|..:|
 Frog   142 NGCVDKRELKEIIQSIYSIKRGWRRDQEAQLMSPEEICERIFQIVDENGDGQLSLQEFVEGAKKD 206

  Fly   178 EELSKML 184
            ..:.|||
 Frog   207 TWVLKML 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 62/168 (37%)
guca1blXP_004913416.1 FRQ1 56..207 CDD:227455 58/154 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.