DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and XB5856770

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001096526.1 Gene:XB5856770 / 100125166 XenbaseID:XB-GENE-5856771 Length:211 Species:Xenopus tropicalis


Alignment Length:159 Identity:57/159 - (35%)
Similarity:96/159 - (60%) Gaps:5/159 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEEFCDHVFRTFDMDKNGYIDFKEFLLAIDV 93
            :.|||:.|.|:||:|.:|..:|...:........:.|:.:.:||..|.:.:|.:||:|::.||.:
 Frog    18 LHEWYRKFVQECPSGLITLHEFRKYFCDCTVGTESSEYAEKIFRNLDKNGDGIVDFREYVTAISM 82

  Fly    94 TSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGACS---SNRPADSAEERAKNIFA 155
            .:.|:|||||:|:|.:||.|.:|.|...||..|::|:|.|..|.|   ||.|  :|||....||.
 Frog    83 LAQGSPEEKLRWSFELYDKDRDGTITRCEMLDIMKAVYKMSLATSLAQSNPP--TAEECTNRIFI 145

  Fly   156 KMDENNDGQLTQDEFLKGCLQDEELSKML 184
            ::|::::..::..||:.|.|.|:.:..||
 Frog   146 RLDKDHNALISLQEFIDGSLDDDWIRDML 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 54/151 (36%)
XB5856770NP_001096526.1 FRQ1 17..167 CDD:227455 54/150 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.