DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and GUCA1C

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_005450.3 Gene:GUCA1C / 9626 HGNCID:4680 Length:209 Species:Homo sapiens


Alignment Length:158 Identity:59/158 - (37%)
Similarity:95/158 - (60%) Gaps:6/158 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFLCALS 90
            |...||:.|:.:.|||..::.|||.:.|.......|:|..:.|:.|||.|.||.:||.||:.|::
Human    18 ETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFVDFLEFIAAVN 82

  Fly    91 VTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKMPEDESTPEKRTDKIFRQ 155
            :..:.|:||||||.|.:||.||||.|.:.|:|::..|:..:.|      :...:||:..:.:|.:
Human    83 LIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNG------QQTLSPEEFINLVFHK 141

  Fly   156 MDRNKDGKLSLEEFIEGAKSDPSIVRLL 183
            :|.|.||:|:|||||.|...|..::.::
Human   142 IDINNDGELTLEEFINGMAKDQDLLEIV 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 59/152 (39%)
GUCA1CNP_005450.3 FRQ1 15..165 CDD:227455 59/152 (39%)
EFh 56..118 CDD:238008 29/61 (48%)
EFh 92..160 CDD:238008 30/73 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..209
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.