DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and FRQ1

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_010661.3 Gene:FRQ1 / 851979 SGDID:S000002781 Length:190 Species:Saccharomyces cerevisiae


Alignment Length:183 Identity:100/183 - (54%)
Similarity:133/183 - (72%) Gaps:0/183 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFA 65
            ||.:.|||..:.|..|||:|.|...|||:|:||||:|||||.|:.|:|.|||..|||:|....||
Yeast     1 MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVKIYKQFFPFGSPEDFA 65

  Fly    66 EHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYK 130
            .|:|..||.:.:|.|.|.||:..||.||||.||:||.|||.:|||:.:|||:..|||.||.::||
Yeast    66 NHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEKLSWAFELYDLNHDGYITFDEMLTIVASVYK 130

  Fly   131 MVGSVMKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLL 183
            |:||::.:.|||:|||.|..|||:.||:|:||.::|:||.||:|.||||:..|
Yeast   131 MMGSMVTLNEDEATPEMRVKKIFKLMDKNEDGYITLDEFREGSKVDPSIIGAL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 92/165 (56%)
FRQ1NP_010661.3 FRQ1 4..179 CDD:227455 95/174 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 93 1.000 Domainoid score I1702
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm46685
orthoMCL 1 0.900 - - OOG6_100764
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
TreeFam 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.