DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and SOS3

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001190377.1 Gene:SOS3 / 832494 AraportID:AT5G24270 Length:222 Species:Arabidopsis thaliana


Alignment Length:188 Identity:60/188 - (31%)
Similarity:100/188 - (53%) Gaps:16/188 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KQNSKLKPEVLED---LKQNTEFTDAEIQEWYKGFLKDCPS----GHLSVEEFK-KIYGNFFPYG 59
            |:.:.::|...||   |...|.||..|::..|:.|.|...|    |.:..|||: .::.|   ..
plant     9 KKKNAMRPPGYEDPELLASVTPFTVEEVEALYELFKKLSSSIIDDGLIHKEEFQLALFRN---RN 70

  Fly    60 DASKFAEHVFRTFDANGDGTIDFREFLCALSV-TSRGKLEQKLKWAFSMYDLDGNGYISRQEMLE 123
            ..:.||:.:|..||...:|.|:|.||:.:|.| .....:.:|:|:||.:|||...|:|.|:|:.|
plant    71 RRNLFADRIFDVFDVKRNGVIEFGEFVRSLGVFHPSAPVHEKVKFAFKLYDLRQTGFIEREELKE 135

  Fly   124 IVTAIYKMVGSVMKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVR 181
            :|.|:  :..|.:.:.||  ..|...||.|.|.||..|||:.::|:.:....:||:::
plant   136 MVVAL--LHESELVLSED--MIEVMVDKAFVQADRKNDGKIDIDEWKDFVSLNPSLIK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 57/174 (33%)
SOS3NP_001190377.1 FRQ1 29..187 CDD:227455 54/164 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4318
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 1 0.900 - - OOG6_100764
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.