DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and CBL3

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001320073.1 Gene:CBL3 / 828764 AraportID:AT4G26570 Length:230 Species:Arabidopsis thaliana


Alignment Length:193 Identity:59/193 - (30%)
Similarity:91/193 - (47%) Gaps:27/193 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KQNSKL-KPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPS----GHLSVEEF--------KKIYGN 54
            ||:..| .||:   |.:.|.|:.:||:..|:.|.|...:    |.::.|||        ||  .:
plant    25 KQSGGLGDPEL---LARETVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKK--ES 84

  Fly    55 FFPYGDASKFAEHVFRTFDANGDGTIDFREFLCALSV-TSRGKLEQKLKWAFSMYDLDGNGYISR 118
            .|    |.::...||..||...:|.:.|.||..|||| .....:|.|:.::|.:|||...|:|.|
plant    85 LF----ADRYQSQVFDLFDTKHNGILGFEEFARALSVFHPNAPIEDKIDFSFQLYDLKQQGFIER 145

  Fly   119 QEMLEIVTAIYKMVGSVMKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVR 181
            ||:.::|.|.....|    |...:...|...||.|.:.|...||::..||:.......||:::
plant   146 QEVKQMVVATLAESG----MNLSDEIIESIIDKTFEEADTKHDGRIDKEEWRTLVLRHPSLLK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 53/178 (30%)
CBL3NP_001320073.1 EFh_PEF 40..202 CDD:330173 52/171 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.