DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and CBL7

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_194386.1 Gene:CBL7 / 828763 AraportID:AT4G26560 Length:214 Species:Arabidopsis thaliana


Alignment Length:182 Identity:53/182 - (29%)
Similarity:81/182 - (44%) Gaps:31/182 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FTDAEIQE-WYKGFLK----DCPSGHLSVEEFKKIYGNFFPYGDASK----------------FA 65
            |||.:.:: .|:.|.|    ||.....:|.|....|     ||:.:|                |:
plant    16 FTDQKKRKALYEVFKKLSGVDCQRNEGNVVEGVTCY-----YGEMNKEQFHVAIFQTDKNESLFS 75

  Fly    66 EHVFRTFDANGDGTIDFREFLCALSV-TSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIY 129
            |.||..||.|.||.:.|.||..|||| .....::.|:..:|.:|||...|:|.||.:.::|.|..
plant    76 ERVFDLFDTNHDGLLGFEEFARALSVFHPSAPIDDKIDLSFQLYDLKQQGFIERQGVKQLVVATL 140

  Fly   130 KMVGSVMKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVR 181
            ...|    |.:.:...|...||.|.|.|...:|.:..||:::.....|.:::
plant   141 AASG----MSQSDEIVESIIDKTFVQADTKHEGMIDEEEWMDLVFRHPLLLK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 53/178 (30%)
CBL7NP_194386.1 FRQ1 <74..186 CDD:227455 39/115 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.