DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and CBL6

DIOPT Version :10

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_567492.1 Gene:CBL6 / 827330 AraportID:AT4G16350 Length:226 Species:Arabidopsis thaliana


Alignment Length:33 Identity:9/33 - (27%)
Similarity:15/33 - (45%) Gaps:1/33 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IQWEGFKYNRDEFRETRLKQYD-NFVNILRPSS 68
            |..:|..|.|....|.....:| .:.::|.|:|
plant   185 INTQGSSYPRSGMHEVYSTHFDPRYSSLLVPAS 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 21..175 CDD:444056 9/33 (27%)
CBL6NP_567492.1 PTZ00183 44..190 CDD:185503 1/4 (25%)

Return to query results.
Submit another query.