DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and hpcal4

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001072798.1 Gene:hpcal4 / 780259 XenbaseID:XB-GENE-995790 Length:191 Species:Xenopus tropicalis


Alignment Length:190 Identity:131/190 - (68%)
Similarity:161/190 - (84%) Gaps:2/190 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFA 65
            |||.||||.||:|:||.|:|||::.|::.||||||||||||.|:::||:::|..|||||||||||
 Frog     1 MGKPNSKLAPEMLQDLVQSTEFSEQELKHWYKGFLKDCPSGILNLQEFQQLYIKFFPYGDASKFA 65

  Fly    66 EHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYK 130
            :|.|||||.|||||||||||:|||||||||..||||.|||.||||||:|.|:|.|||||:.||||
 Frog    66 QHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGKITRLEMLEIIEAIYK 130

  Fly   131 MVGSV--MKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQCDPQ 188
            |||:|  |:|.:|..||::|.||||.:||:::|.:::||||.|.||||||||.|||||.|
 Frog   131 MVGTVIMMRMNQDGLTPQQRVDKIFAKMDKDRDDQITLEEFKEAAKSDPSIVLLLQCDMQ 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 113/167 (68%)
hpcal4NP_001072798.1 FRQ1 13..181 CDD:227455 113/167 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11487
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.