DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and 1700109H08Rik

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_084119.1 Gene:1700109H08Rik / 77036 MGIID:1924286 Length:210 Species:Mus musculus


Alignment Length:179 Identity:47/179 - (26%)
Similarity:89/179 - (49%) Gaps:18/179 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLKPEVLEDLKQNTEF-TDAEIQEWYKGFLKDCPSGH-----LSVEEFKKIYGNFFPYGDASKFA 65
            |:...:.:.:|...:| .:..|:.:|.  |..||.|.     |....|:.:..|.|...: ....
Mouse     8 KMVESIRKTVKSFKKFEVECLIRLFYS--LVGCPVGKMDNTGLDCNTFRGVLQNIFGMTN-DMLM 69

  Fly    66 EHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYK 130
            ..||..||.:|||.::..|::..|:|..||..|:|:::.|.:|.|:|:.|||::::.:::.:   
Mouse    70 NRVFFVFDKDGDGYVNLEEWIKGLAVFLRGTFEEKMRFCFEVYYLNGDAYISQEKIFDMLKS--- 131

  Fly   131 MVGSVMKMPEDESTPEKRTDKI---FRQMDRNKDGKLSLEEFIEGAKSD 176
               |:.:...:|...|...|.:   .::||.:.|||:|..:|.:..|.|
Mouse   132 ---SLFQHSPEEENEEGVKDLVEISLKKMDYDNDGKISFADFEKAVKED 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 46/173 (27%)
1700109H08RikNP_084119.1 EFh 71..130 CDD:298682 21/58 (36%)
EF-hand_7 105..174 CDD:290234 18/74 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.