DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and hpca

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_012812581.2 Gene:hpca / 733559 XenbaseID:XB-GENE-491920 Length:234 Species:Xenopus tropicalis


Alignment Length:189 Identity:166/189 - (87%)
Similarity:179/189 - (94%) Gaps:0/189 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFA 65
            ||||||||:||:|:||::||||:|.|:||||||||||||||.|:||||||||.||||||||||||
 Frog    42 MGKQNSKLRPEMLQDLRENTEFSDHELQEWYKGFLKDCPSGILNVEEFKKIYANFFPYGDASKFA 106

  Fly    66 EHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYK 130
            ||||||||.|||||||||||:.|||||||||||||||||||||||||||||||:||||||.||||
 Frog   107 EHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISREEMLEIVQAIYK 171

  Fly   131 MVGSVMKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQCDPQS 189
            ||.||||||||||||||||:|||||||.|.||||||||||:||||||||||||||||.:
 Frog   172 MVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIKGAKSDPSIVRLLQCDPST 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 146/165 (88%)
hpcaXP_012812581.2 FRQ1 54..220 CDD:227455 146/165 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4799
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4678
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.