DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and Kcnip1

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_006246167.1 Gene:Kcnip1 / 65023 RGDID:70886 Length:245 Species:Rattus norvegicus


Alignment Length:176 Identity:79/176 - (44%)
Similarity:121/176 - (68%) Gaps:0/176 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFD 73
            :||.||.|:..|.||..|:|..|:||..:||||.::.|.||:||..|||:||||.:|.::|..||
  Rat    64 RPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEETFKQIYAQFFPHGDASTYAHYLFNAFD 128

  Fly    74 ANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKM 138
            ....|::.|.:|:.|||:..||.:.:||:|.|::||::.:|||:::||::||.|||.|:|.....
  Rat   129 TTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYP 193

  Fly   139 PEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQ 184
            ...|.||.:..|..|::||:||||.::|:||:|..:.|.:|:|.||
  Rat   194 VLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQ 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 73/165 (44%)
Kcnip1XP_006246167.1 FRQ1 68..234 CDD:227455 73/165 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.