DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and RCVRN

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_002894.1 Gene:RCVRN / 5957 HGNCID:9937 Length:200 Species:Homo sapiens


Alignment Length:193 Identity:99/193 - (51%)
Similarity:144/193 - (74%) Gaps:7/193 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKQNSK---LKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDAS 62
            ||  |||   |..|:||:|:.||:|::.|:..||:.||||||:|.::.::|:.||..|||..|..
Human     1 MG--NSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPK 63

  Fly    63 KFAEHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTA 127
            .:|:||||:||:|.|||:||:|::.||.:|:.||..|||:||||:||:||||.||:.|:||||.|
Human    64 AYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMA 128

  Fly   128 IYKMV--GSVMKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQCDPQ 188
            |:||:  ..|..:|:||:|||||.:||::...:|.|.||:.:|||||..::..|:||:|.:||
Human   129 IFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQ 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 86/167 (51%)
RCVRNNP_002894.1 FRQ1 14..182 CDD:227455 86/167 (51%)
Interaction with GRK1. /evidence=ECO:0000250|UniProtKB:P21457 189..192 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.