DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and hpcal4

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001108159.1 Gene:hpcal4 / 564909 ZFINID:ZDB-GENE-060503-307 Length:191 Species:Danio rerio


Alignment Length:190 Identity:133/190 - (70%)
Similarity:162/190 - (85%) Gaps:2/190 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFA 65
            |||.||||.||||:||.::|||.:||:::||||||||||||.|::|||:::|..|||||||||||
Zfish     1 MGKHNSKLAPEVLDDLTKSTEFNEAELKQWYKGFLKDCPSGILNLEEFQQLYVKFFPYGDASKFA 65

  Fly    66 EHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYK 130
            :|.|||||.|||||||||||:||||:||||..||||.|||:||||||:|.|:|.|||||:.||||
Zfish    66 QHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRMEMLEIIEAIYK 130

  Fly   131 MVGSV--MKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQCDPQ 188
            |||:|  |:|.||..||::|.||||.:||::.:.::|||||.|.||||||||.|||||.|
Zfish   131 MVGTVIMMRMNEDGLTPQQRVDKIFSKMDKDHNDEISLEEFKEAAKSDPSIVLLLQCDMQ 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 114/167 (68%)
hpcal4NP_001108159.1 FRQ1 15..181 CDD:227455 113/165 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11797
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.