DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and si:ch211-245j22.3

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001074270.1 Gene:si:ch211-245j22.3 / 563798 ZFINID:ZDB-GENE-050419-38 Length:194 Species:Danio rerio


Alignment Length:164 Identity:68/164 - (41%)
Similarity:112/164 - (68%) Gaps:0/164 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFLCALS 90
            |:.||::.||.:||||.:::.||::.:.|.....:::::||.:|||.|.||||.:||||::.|:|
Zfish    18 ELYEWFRKFLNECPSGLITLHEFRRHFCNGTVGKESAEYAEQIFRTLDNNGDGVVDFREYVTAIS 82

  Fly    91 VTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKMPEDESTPEKRTDKIFRQ 155
            :...|...:||:|:|.:||.|.:|.|:|.|||||:.|:|||..:......|..|.|:.|::||.:
Zfish    83 MLIEGSTVEKLRWSFKLYDKDKDGAITRSEMLEIMQAVYKMSVAASLTKPDPLTAEECTNRIFVR 147

  Fly   156 MDRNKDGKLSLEEFIEGAKSDPSIVRLLQCDPQS 189
            :|::.:..:|.:||||||.:|..|..:|:|||.:
Zfish   148 LDKDNNAIISQDEFIEGALNDEWIREMLECDPNT 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 63/152 (41%)
si:ch211-245j22.3NP_001074270.1 EF-hand_8 31..78 CDD:290545 20/46 (43%)
EF-hand_7 32..81 CDD:290234 19/48 (40%)
EFh 56..118 CDD:238008 32/61 (52%)
EF-hand_7 57..117 CDD:290234 31/59 (53%)
EFh 92..164 CDD:238008 30/71 (42%)
EF-hand_7 93..163 CDD:290234 28/69 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.