DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and efcab1

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001038325.1 Gene:efcab1 / 558421 ZFINID:ZDB-GENE-040914-40 Length:216 Species:Danio rerio


Alignment Length:180 Identity:52/180 - (28%)
Similarity:90/180 - (50%) Gaps:18/180 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKQNSKLKPEVLEDL-KQNTEFTDAEIQ---EWYKGFLKDCPSGHLSV----EEFKKIYGNFFP 57
            |...|.||...:.|.| :|...|...|.:   ..:...|.:......::    .:|:.|..:.|.
Zfish     4 MSAMNRKLIQNLAETLCRQVKHFNKTETECLIRLFNSLLGEQAERKTTIGVDRAKFRNILHHTFG 68

  Fly    58 YGDASKFAEHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEML 122
            ..| ....:.|.|..|.:.||.:..:|::.||||..||.|::|:|:.|.:|||:|:|||||:||.
Zfish    69 MTD-DMMTDRVCRVIDKDNDGYLSVKEWVEALSVFLRGTLDEKMKYCFEVYDLNGDGYISREEMF 132

  Fly   123 EIVTAIYKMVGSVMKMPEDESTPEKRTDKI---FRQMDRNKDGKLSLEEF 169
            ::      :..|:::.|.:|...|...|.:   .::||.:.||::|..:|
Zfish   133 QM------LKDSLIRQPTEEDPDEGIKDIVEIALKKMDYDHDGRVSYADF 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 48/168 (29%)
efcab1NP_001038325.1 EFh 80..136 CDD:238008 26/61 (43%)
EF-hand_7 80..135 CDD:290234 26/60 (43%)
EFh 110..176 CDD:238008 24/71 (34%)
EF-hand_7 111..178 CDD:290234 24/72 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.