DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and ncalda

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001107882.1 Gene:ncalda / 556178 ZFINID:ZDB-GENE-080220-28 Length:193 Species:Danio rerio


Alignment Length:189 Identity:165/189 - (87%)
Similarity:181/189 - (95%) Gaps:0/189 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFA 65
            ||||||||:|||::||.::|:||:.||||||||||:|||||:||:||||||||||||||||||||
Zfish     1 MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGNLSMEEFKKIYGNFFPYGDASKFA 65

  Fly    66 EHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYK 130
            ||||||||||||||||||||:.||||||||||||||||||||||||||||||:.||||||.||||
Zfish    66 EHVFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKSEMLEIVQAIYK 130

  Fly   131 MVGSVMKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQCDPQS 189
            ||.||||||||||||||||:|||||||.|:||||||||||:|||:||||||||||||.|
Zfish   131 MVSSVMKMPEDESTPEKRTEKIFRQMDTNRDGKLSLEEFIKGAKTDPSIVRLLQCDPSS 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 143/165 (87%)
ncaldaNP_001107882.1 FRQ1 14..179 CDD:227455 143/164 (87%)
EFh <36..89 CDD:298682 47/52 (90%)
EFh 65..126 CDD:238008 56/60 (93%)
EFh 100..174 CDD:238008 65/73 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596707
Domainoid 1 1.000 139 1.000 Domainoid score I4743
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 353 1.000 Inparanoid score I2220
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm26459
orthoMCL 1 0.900 - - OOG6_100764
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.