DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and ncs1b

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001018350.1 Gene:ncs1b / 553174 ZFINID:ZDB-GENE-050930-1 Length:190 Species:Danio rerio


Alignment Length:183 Identity:116/183 - (63%)
Similarity:147/183 - (80%) Gaps:0/183 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFA 65
            |||.||||||||:|:|.:.|.||:.|:|:|||||:||||||.|....|:|||..|||:||.:|||
Zfish     1 MGKSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFA 65

  Fly    66 EHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYK 130
            ..||..||.|.||.|:|.||:.||||||||.|::||:|||.:||||.:|||:|.|||.||.|||:
Zfish    66 SFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRDEMLNIVDAIYQ 130

  Fly   131 MVGSVMKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLL 183
            |||:.:.:||:|:|||||.|:||..||:|.||||:|:||.||:|:|||||:.|
Zfish   131 MVGNTVDLPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQAL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 101/165 (61%)
ncs1bNP_001018350.1 FRQ1 20..179 CDD:227455 99/158 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100764
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.