DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and efcab1

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001016778.1 Gene:efcab1 / 549532 XenbaseID:XB-GENE-5727529 Length:208 Species:Xenopus tropicalis


Alignment Length:146 Identity:49/146 - (33%)
Similarity:77/146 - (52%) Gaps:11/146 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDG 112
            |:.|..|.|...| ....:.|||.||.:.|..|...|::..|||..||.||:::|:.|.:|||:|
 Frog    53 FRNILHNTFGMTD-DMIMDRVFRGFDKDNDSYISVTEWVEGLSVFLRGTLEERIKYCFGVYDLNG 116

  Fly   113 NGYISRQEMLEIVTAIYKMVGSVMKMPEDESTPEKRTDKI---FRQMDRNKDGKLSLEEFIEGAK 174
            :|||||:||      .:.:..|::|.|.:|...|...|.:   .::||.:.|.|||..:|.:..:
 Frog   117 DGYISREEM------FHMLKNSLLKQPSEEDPDEGVKDLVEIALKKMDYDHDSKLSYMDFEKAVQ 175

  Fly   175 SDPSIVRLL-QCDPQS 189
            .:..::... .|.|.|
 Frog   176 EENLLLEAFGPCLPDS 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 46/133 (35%)
efcab1NP_001016778.1 EF-hand_7 69..129 CDD:290234 28/65 (43%)
EFh 71..130 CDD:238008 28/64 (44%)
EFh 104..175 CDD:238008 26/76 (34%)
EF-hand_7 105..174 CDD:290234 26/74 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.