DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and Ncald

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001164337.1 Gene:Ncald / 52589 MGIID:1196326 Length:193 Species:Mus musculus


Alignment Length:189 Identity:167/189 - (88%)
Similarity:180/189 - (95%) Gaps:0/189 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFA 65
            ||||||||:|||::||.::|:||:.||||||||||:||||||||:||||||||||||||||||||
Mouse     1 MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFA 65

  Fly    66 EHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYK 130
            ||||||||||||||||||||:.||||||||||||||||||||||||||||||:.||||||.||||
Mouse    66 EHVFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYK 130

  Fly   131 MVGSVMKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQCDPQS 189
            ||.||||||||||||||||:|||||||.|:||||||||||.||||||||||||||||.|
Mouse   131 MVSSVMKMPEDESTPEKRTEKIFRQMDTNRDGKLSLEEFIRGAKSDPSIVRLLQCDPSS 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 145/165 (88%)
NcaldNP_001164337.1 FRQ1 14..179 CDD:227455 145/164 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850707
Domainoid 1 1.000 139 1.000 Domainoid score I4763
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 350 1.000 Inparanoid score I2267
Isobase 1 0.950 - 0 Normalized mean entropy S251
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm43680
orthoMCL 1 0.900 - - OOG6_100764
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.720

Return to query results.
Submit another query.