DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and guca1d

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001011661.1 Gene:guca1d / 494573 ZFINID:ZDB-GENE-040724-231 Length:185 Species:Danio rerio


Alignment Length:184 Identity:68/184 - (36%)
Similarity:105/184 - (57%) Gaps:17/184 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFA 65
            ||..::.|...:.||:           ..||..|:::.|||.:::.|.|.|.|......||:.:.
Zfish     1 MGNNHASLDDILAEDM-----------HHWYNKFMRESPSGLITLFELKSILGLQGMNEDANSYV 54

  Fly    66 EHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYK 130
            :.||.|||.:.||.|||.|::.|:|:..:|::.|||||.|.::|.||||.|.:.|:..|.|||..
Zfish    55 DQVFCTFDMDRDGYIDFVEYIAAISLMLKGEINQKLKWYFKLFDQDGNGKIDKDELETIFTAIQD 119

  Fly   131 MVGSVMKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQ 184
            :..:      .:..||:....||.::|.|.:|:|:|||||||||..|.|:.:|:
Zfish   120 ITRN------RDIVPEEIVALIFEKIDVNGEGELTLEEFIEGAKEHPEIMDMLK 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 63/165 (38%)
guca1dNP_001011661.1 EF-hand_8 28..76 CDD:290545 20/47 (43%)
EFh 53..110 CDD:238008 26/56 (46%)
EF-hand_7 56..114 CDD:290234 27/57 (47%)
EFh 89..157 CDD:238008 31/73 (42%)
EF-hand_7 90..154 CDD:290234 27/69 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.