DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and guca1g

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001011660.1 Gene:guca1g / 494572 ZFINID:ZDB-GENE-050120-1 Length:187 Species:Danio rerio


Alignment Length:186 Identity:71/186 - (38%)
Similarity:111/186 - (59%) Gaps:14/186 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFA 65
            ||:..|       ::.::..|.|  |||..|..|:|.||||.|.:.||::|:|......:.:.:.
Zfish     1 MGQNQS-------DEEEEEVELT--EIQPLYTRFMKVCPSGALHLHEFRRIFGVQSSSEEEALYM 56

  Fly    66 EHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYK 130
            |.:|::||.|.|..|||.||:.|:.:..||.||.:|||:|.:||.|.||.:.|||::.::..:.|
Zfish    57 ETIFKSFDTNRDNVIDFMEFVAAVHLVLRGNLEDRLKWSFKVYDRDENGKLDRQEVIHVIRILCK 121

  Fly   131 MVGSVMKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQCD 186
            :..:.:.|     ||.:..|:||..:|.|.||::||.||:|||:.|..|:.||:.|
Zfish   122 LKKNRINM-----TPVEICDRIFELLDENNDGQISLSEFLEGAEKDAWIMDLLKLD 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 64/165 (39%)
guca1gNP_001011660.1 EF-hand_8 30..80 CDD:290545 19/49 (39%)
EFh 59..117 CDD:238008 27/57 (47%)
EFh 91..158 CDD:238008 27/71 (38%)
EF-hand_7 92..157 CDD:290234 27/69 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.