DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and ncaldb

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001003776.1 Gene:ncaldb / 445319 ZFINID:ZDB-GENE-040808-37 Length:192 Species:Danio rerio


Alignment Length:189 Identity:163/189 - (86%)
Similarity:178/189 - (94%) Gaps:0/189 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFA 65
            ||||||||:|||::||..||:||:.||.|||||||:|||||.||::|||||||||||||||||||
Zfish     1 MGKQNSKLRPEVIQDLLDNTDFTEHEILEWYKGFLRDCPSGALSMDEFKKIYGNFFPYGDASKFA 65

  Fly    66 EHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYK 130
            ||||||||||||||||||||:.||||||||:|:|||||||||||||||||||:.||||||.||||
Zfish    66 EHVFRTFDANGDGTIDFREFIIALSVTSRGRLDQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYK 130

  Fly   131 MVGSVMKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQCDPQS 189
            ||.||||||||||||||||||||||||.|:|||||||||:||||:||||||||||||.|
Zfish   131 MVSSVMKMPEDESTPEKRTDKIFRQMDTNRDGKLSLEEFVEGAKNDPSIVRLLQCDPSS 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 141/165 (85%)
ncaldbNP_001003776.1 FRQ1 13..179 CDD:227455 141/165 (85%)
EFh <36..89 CDD:298682 46/52 (88%)
EFh 65..126 CDD:238008 54/60 (90%)
EFh 100..174 CDD:238008 66/73 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100764
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.