DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and CG5890

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster


Alignment Length:175 Identity:75/175 - (42%)
Similarity:115/175 - (65%) Gaps:0/175 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDA 74
            |..||||.:.|:||..||:..|:||..:||.|.:..:.||.||..|||:|::|.:|.:||:.||.
  Fly    26 PVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDV 90

  Fly    75 NGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKMP 139
            |.:|.|.||:.|..||...||.:.::|:|.|.:|||:|:|.|||.|:.||:.||::::|.....|
  Fly    91 NCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQP 155

  Fly   140 EDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQ 184
            ||:.....:.|::||::|.|:||.:::|||:|....|..:.|.||
  Fly   156 EDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 71/165 (43%)
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 70/162 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442294
Domainoid 1 1.000 51 1.000 Domainoid score I4318
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
87.990

Return to query results.
Submit another query.