DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and d-cup

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_650235.1 Gene:d-cup / 41580 FlyBaseID:FBgn0038089 Length:219 Species:Drosophila melanogaster


Alignment Length:170 Identity:42/170 - (24%)
Similarity:77/170 - (45%) Gaps:19/170 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FTDAEI----QEWYKGFLKDCPSG-HLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTID 81
            |.|:|:    ..:||..|::.||. .::..:|..|...|....|.......|  |..|.|...:.
  Fly    32 FNDSEVTCILMIYYKYSLQNGPSARRITSSQFVNIVIGFQQLYDMDVVDRIV--TLIAGGRKHVT 94

  Fly    82 FREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKMPEDESTPE 146
            ..||:..:::.....:|:|:::|:.:||.:|.| |:|:.:...|...:  ||      :|:...|
  Fly    95 PMEFVNYMTILMSRDMERKMEFAYMVYDKNGMG-INREIISSSVERFF--VG------DDDEVLE 150

  Fly   147 KRTDKI---FRQMDRNKDGKLSLEEFIEGAKSDPSIVRLL 183
            .|.|.:   ..:.|.::||.:|.||:.......|.::..|
  Fly   151 MRLDMVDFLLLKFDEDQDGYISFEEYRSIVLQQPRLLEFL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 41/164 (25%)
d-cupNP_650235.1 EF-hand_7 114..180 CDD:290234 20/74 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442313
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.