DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and sowi

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster


Alignment Length:193 Identity:43/193 - (22%)
Similarity:87/193 - (45%) Gaps:24/193 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QNSK---LKPEVLEDLKQNTEFTDAEIQ----EWYKGFLKDCPS-GHLSVEEFKKIYGNFFPYGD 60
            :||:   |...::::|...:|.:..:|.    .:||....:.|. ..::.::|.:|:...|....
  Fly    12 ENSRFAALYGSLIKELTLTSELSQTDITCLLVVYYKFSKANGPQCKQMTKKQFYQIFLVLFNVAS 76

  Fly    61 ASKFAEHVFRTFDANGDGT--IDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLE 123
                .:.:.||..|....|  :..|.::....:.:...::.::::||.:||..|.|.|.|:   :
  Fly    77 ----VQVIERTLLAITKDTKYVSPRAWIHLFDLYTTNDIQVRMRFAFEVYDTKGTGVIDRE---Q 134

  Fly   124 IVTAIYK-MVGSVMKMPEDESTPEK--RTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLL 183
            :.||..| ..|.    .|||....|  .|:.:.::.|.:|||.:|.|::....:..|.:|..|
  Fly   135 VGTACEKFFYGE----DEDELNELKADMTEFLMKKFDLDKDGVISYEDYSTVVEQQPILVEFL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 38/175 (22%)
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 23/70 (33%)
EFh 116..178 CDD:238008 22/68 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442311
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.