DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and hpcal1

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_957458.1 Gene:hpcal1 / 394139 ZFINID:ZDB-GENE-040426-1242 Length:193 Species:Danio rerio


Alignment Length:189 Identity:162/189 - (85%)
Similarity:173/189 - (91%) Gaps:0/189 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFA 65
            ||||||||:||||.||::||||||.|:||||:|||||||||||:||||||||.||||||||||||
Zfish     1 MGKQNSKLRPEVLNDLRENTEFTDHELQEWYRGFLKDCPSGHLTVEEFKKIYANFFPYGDASKFA 65

  Fly    66 EHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYK 130
            ||||||||.|.|.|||||||:.||||||||.|||||:||||||||||||||||.||||||.||||
Zfish    66 EHVFRTFDTNSDATIDFREFIIALSVTSRGGLEQKLRWAFSMYDLDGNGYISRAEMLEIVQAIYK 130

  Fly   131 MVGSVMKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQCDPQS 189
            ||.||||||||||||||||||||||||.:.||:|||||||:|||||||||||||.|..|
Zfish   131 MVSSVMKMPEDESTPEKRTDKIFRQMDTDNDGRLSLEEFIKGAKSDPSIVRLLQSDQSS 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 142/165 (86%)
hpcal1NP_957458.1 FRQ1 13..179 CDD:227455 142/165 (86%)
EFh <36..89 CDD:298682 45/52 (87%)
EFh 65..126 CDD:238008 52/60 (87%)
EFh 100..174 CDD:238008 64/73 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4743
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37586
Inparanoid 1 1.050 353 1.000 Inparanoid score I2220
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100764
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.