DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and Frq2

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster


Alignment Length:183 Identity:109/183 - (59%)
Similarity:140/183 - (76%) Gaps:1/183 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFA 65
            |||:|||||.:.::.|..:|.||:.||::|:||||||||:|.|:.:.|.|||..|||.||.||||
  Fly     1 MGKKNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKFA 65

  Fly    66 EHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYK 130
            ..|||.||.|.||.|:|.||:.|||:||||.|::||.|||.:||:|.:|||:|:||..||.|||:
  Fly    66 SLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQ 130

  Fly   131 MVGSVMKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLL 183
            |||. ....|||:||:||.||||.|||:|.|.:|:||||.||:|:||.||:.|
  Fly   131 MVGQ-QPQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQAL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 98/165 (59%)
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 99/169 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442301
Domainoid 1 1.000 51 1.000 Domainoid score I4318
eggNOG 1 0.900 - - E2759_KOG0044
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112087at50557
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 1 0.900 - - OOG6_100764
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
1110.800

Return to query results.
Submit another query.