Sequence 1: | NP_788543.1 | Gene: | Nca / 40186 | FlyBaseID: | FBgn0013303 | Length: | 190 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001265268.1 | Gene: | KCNIP1 / 30820 | HGNCID: | 15521 | Length: | 241 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 78/201 - (38%) |
---|---|---|---|
Similarity: | 121/201 - (60%) | Gaps: | 25/201 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 KPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYG-------------- 59
Fly 60 -----------DASKFAEHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGN 113
Fly 114 GYISRQEMLEIVTAIYKMVGSVMKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPS 178
Fly 179 IVRLLQ 184 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Nca | NP_788543.1 | FRQ1 | 13..179 | CDD:227455 | 72/190 (38%) |
KCNIP1 | NP_001265268.1 | FRQ1 | 39..230 | CDD:227455 | 72/190 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0044 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000038 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X31 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.810 |