DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and Efcab1

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001100400.1 Gene:Efcab1 / 301957 RGDID:1594548 Length:212 Species:Rattus norvegicus


Alignment Length:129 Identity:41/129 - (31%)
Similarity:73/129 - (56%) Gaps:12/129 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 EHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYK 130
            :.|||.||.:.||.|...|::..||:..||.|::|:|:.|.::||:|:|:||::||      .:.
  Rat    71 DRVFRGFDRDNDGCISVSEWVHGLSLFLRGTLDEKMKYCFEVFDLNGDGFISKEEM------FHM 129

  Fly   131 MVGSVMKMPEDESTPEKRTDKI---FRQMDRNKDGKLSLEEFIEGAKSDPSIVRLL-QC--DPQ 188
            :..|::|.|.:|...|...|.:   .::||.:.|||||..::....:.:..::... .|  ||:
  Rat   130 LKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFVDYETAVREETLLLEAFGPCLPDPK 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 38/115 (33%)
Efcab1NP_001100400.1 EF-hand_7 70..130 CDD:290234 25/64 (39%)
EFh 72..131 CDD:238008 25/64 (39%)
EFh 105..168 CDD:238008 23/68 (34%)
EF-hand_7 106..175 CDD:290234 23/74 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.