DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and GUCA1B

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_002089.4 Gene:GUCA1B / 2979 HGNCID:4679 Length:200 Species:Homo sapiens


Alignment Length:198 Identity:89/198 - (44%)
Similarity:122/198 - (61%) Gaps:19/198 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGD---AS 62
            ||::.|      .|:.:...|...||:|||||.|:.:||||.|.:.|||:    ||...|   ||
Human     1 MGQEFS------WEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKR----FFKVTDDEEAS 55

  Fly    63 KFAEHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTA 127
            ::.|.:||.||.|||.||||.|::.||::..||.||.||||.|.:||.||||.|.|.|:|.||..
Human    56 QYVEGMFRAFDKNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDGNGCIDRLELLNIVEG 120

  Fly   128 IYKMVGSVMKMPEDES----TPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQCD-- 186
            ||::..:..:..:.|.    |||:..|:||..:|.|.||:|||.||:|||:.|..::::||.|  
Human   121 IYQLKKACRRELQTEQGQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDMN 185

  Fly   187 PQS 189
            |.|
Human   186 PSS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 81/172 (47%)
GUCA1BNP_002089.4 FRQ1 20..174 CDD:227455 77/157 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.