DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and Vsnl1

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_036818.2 Gene:Vsnl1 / 24877 RGDID:3966 Length:191 Species:Rattus norvegicus


Alignment Length:190 Identity:135/190 - (71%)
Similarity:162/190 - (85%) Gaps:2/190 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFA 65
            ||||||||.|||:|||.::|||.:.|:::||||||||||||.|::|||:::|..|||||||||||
  Rat     1 MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFA 65

  Fly    66 EHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYK 130
            :|.|||||.|||||||||||:||||:||||..||||.|.|:||||||:|.|:|.|||||:.||||
  Rat    66 QHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWVFNMYDLDGDGKITRVEMLEIIEAIYK 130

  Fly   131 MVGSV--MKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQCDPQ 188
            |||:|  |||.||..|||:|.||||.:||:|||.:::|:||.|.||||||||.|||||.|
  Rat   131 MVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQ 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 115/167 (69%)
Vsnl1NP_036818.2 FRQ1 15..181 CDD:227455 114/165 (69%)
EFh 65..125 CDD:238008 45/59 (76%)
EFh 100..176 CDD:238008 48/75 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11401
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.